Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (ost2)

This Recombinant Dictyostelium discoideum Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2 (ost2) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit 2, Oligosaccharyl transferase subunit 2, EC= 2.4.1.119

UniProt

Q54FB6

Expression Region

1-120

Origin

Dictyostelium discoideum (Slime mold)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSTTASTSSNNLTFTSIVKSFFESYSKTPQKLKIIDLFLIYTFITGVIVFTYCCLVGTYP FNSFLAAFISTVGCFVLTVCLRIQINPINNFGKTISIERAFTDYLLCNLILHLVVFNFLG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL
BNC040679-100 1x 100 µL

CD171 / L1CAM (L1 Cell Adhesion Molecule) (UJ127), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL
BNC680218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL
BNC680994-100 1x 100 µL

TNF alpha (J2D10), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL
BNC040050-100 1x 100 µL

IgA Secretory Component (SC05), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD71 (66IG10), CF594 conjugate, 0.1mg/mL
BNC940871-500 1x 500 µL

CD71 (66IG10), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P27 / KIP1 (KIP1/769), CF640R conjugate, 0.1mg/mL
BNC400769-500 1x 500 µL

P27 / KIP1 (KIP1/769), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details