Recombinant Nymphaea alba NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
This Recombinant Nymphaea alba NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) spans the amino acid sequence from region 1-120.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3
UniProt
Q6EW43
Expression Region
1-120
Origin
Nymphaea alba (White water-lily) (Castalia alba)
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MFLLYEYDIFWAFLMISSVIPILAFLISGVLAPISEGPEKLSSYESGIEPIGDAWIQFRI RYYMFALVFVVFDVETVFLYPWAVSFDILGVYVFIEALIFVLIPVVGSVYAWRKGALEWS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC740040-500 1x 500 µL
CD35 / CR1 (E11), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC880460-100 1x 100 µL
CD44 Standard (156-3C11), CF488A conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401907-500 1x 500 µL
STAT3 / Signal Transducer and Activator of Transcription 3 (PCRP-STAT3-2F12), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC682227-100 1x 100 µL
GFAP (Astrocyte & Neural Stem Cell Marker) (rASTRO/789), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details