Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1)

This Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1) spans the amino acid sequence from region 27-146.

Product Specifications

Product Name Alternative

Stress-responsive DNAJB4-interacting membrane protein 1

UniProt

Q6ZPB5

Expression Region

27-146

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQLIFWSLNAGLDLYLCL ISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPPCHRTDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-CHD9 Antibody
A08334-2 100 µL

Anti-CHD9 Antibody

Sign In for Pricing
View Details
CD40L/Cd40lg Rabbit Polyclonal Antibody (Fluoro488)
orb3115374 100 µg

CD40L/Cd40lg Rabbit Polyclonal Antibody (Fluoro488)

Sign In for Pricing
View Details
Human OR5L1 knockout cell line
ABC-KH10848 1 Vial

Human OR5L1 knockout cell line

Sign In for Pricing
View Details
CD61 Monoclonal Antibody
PA6117-01 1.5 mL

CD61 Monoclonal Antibody

Sign In for Pricing
View Details
CD61 Monoclonal Antibody
PA6117-02 3 mL

CD61 Monoclonal Antibody

Sign In for Pricing
View Details
CD61 Monoclonal Antibody
PA6117-03 6 mL

CD61 Monoclonal Antibody

Sign In for Pricing
View Details