Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1)

This Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1) spans the amino acid sequence from region 27-146.

Product Specifications

Product Name Alternative

Stress-responsive DNAJB4-interacting membrane protein 1

UniProt

Q6ZPB5

Expression Region

27-146

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQLIFWSLNAGLDLYLCL ISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPPCHRTDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PGE2-KLH
orb3185386 1 mg

PGE2-KLH

Sign In for Pricing
View Details
TMX1 Polyclonal Conjugated Antibody
MBS9441174-01 0.1 mL (Biotin)

TMX1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Conjugated Antibody
MBS9441174-02 0.1 mL (AF350)

TMX1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Conjugated Antibody
MBS9441174-03 0.1 mL (AF405)

TMX1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Conjugated Antibody
MBS9441174-04 0.1 mL (AF488)

TMX1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
TMX1 Polyclonal Conjugated Antibody
MBS9441174-05 0.1 mL (AF555)

TMX1 Polyclonal Conjugated Antibody

Sign In for Pricing
View Details