Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1)

This Recombinant Human Stress-responsive DNAJB4-interacting membrane protein 1 (SDIM1) spans the amino acid sequence from region 27-146.

Product Specifications

Product Name Alternative

Stress-responsive DNAJB4-interacting membrane protein 1

UniProt

Q6ZPB5

Expression Region

27-146

Origin

Homo sapiens (Human)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

CGPSPGARTTLGSPLSLWSIKTPSHIFCTRRAINLGFPSPPLVQLIFWSLNAGLDLYLCL ISSCGFSQVFWPVEAFCSFSLSFFALALSHKFVICRLDQHIFSGFTKSLKNLPPCHRTDI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PKIB (NM_032471) Human Untagged Clone
SC111674 10 µg

PKIB (NM_032471) Human Untagged Clone

Sign In for Pricing
View Details
OR1S1 (NM_001004458) Human Tagged ORF Clone Lentiviral Particle
RC216233L3V 200 µL

OR1S1 (NM_001004458) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Cetylpyridinium bromide, Hi-LR™
GRM6765-100G 1 unit

Cetylpyridinium bromide, Hi-LR™

Sign In for Pricing
View Details
Deoxycholic Acid Impurity 10
RM-D221010-01 10 mg

Deoxycholic Acid Impurity 10

Sign In for Pricing
View Details
Deoxycholic Acid Impurity 10
RM-D221010-02 25 mg

Deoxycholic Acid Impurity 10

Sign In for Pricing
View Details
Deoxycholic Acid Impurity 10
RM-D221010-03 50 mg

Deoxycholic Acid Impurity 10

Sign In for Pricing
View Details