Recombinant NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC)
This Recombinant NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic (ndhC) spans the amino acid sequence from region 1-120.
Product Specifications
Product Name Alternative
NAD (P) H-quinone oxidoreductase subunit 3, chloroplastic, EC= 1.6.5.-, NAD (P) H dehydrogenase subunit 3, NADH-plastoquinone oxidoreductase subunit 3
UniProt
Q8M9X8
Expression Region
1-120
Origin
Chaetosphaeridium globosum
Form
Lyophilized powder
Storage Conditions
Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week
Notes
For research use only.
Preservative
Tris/PBS-based buffer, 6% Trehalose, pH 8.0
AA Sequence
MIVFSKYKTFWFFLIIGAIIPTLAFTTSKLLAPTVTTPEKKTSYESGIEPIGEAWIQFQI RYYMFALVFVIFDVETIFLYPWAMSFDQLGVYGFIEALIFVLILVIGLVYAWRKGALEWS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC470204-500 1x 500 µL
Complement C4d (C4D204), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC940158-500 1x 500 µL
Cytokeratin 17 (E3), CF594 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC401820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF640R conjugate, 0.1mg/mL
Sign In for Pricing
View Details