Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reprimo-like protein (RPRML)

This Recombinant Human Reprimo-like protein (RPRML) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

Q8N4K4

Expression Region

1-120

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDER SLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ivacaftor
TRC-I940600-5G 5 g

Ivacaftor

Sign In for Pricing
View Details
Uqcr10 (NM_197979) Mouse Tagged ORF Clone
MG200049 10 µg

Uqcr10 (NM_197979) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Rnf208 Mouse Gene Knockout Kit (CRISPR)
KN514937 1 Kit

Rnf208 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
2-Linoleoyl-rac-glycerol-d5
TRC-L467962-1MG 1 mg

2-Linoleoyl-rac-glycerol-d5

Sign In for Pricing
View Details
Gemin 8 (GEMIN8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G6]
TA805837BM 100 µL

Gemin 8 (GEMIN8) Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2G6]

Sign In for Pricing
View Details
CLEC9A (1F6), CF740 conjugate, 0.1mg/mL
BNC742209-500 1x 500 µL

CLEC9A (1F6), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details