Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reprimo-like protein (RPRML)

This Recombinant Human Reprimo-like protein (RPRML) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

Q8N4K4

Expression Region

1-120

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDER SLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF740 conjugate, 0.1mg/mL
BNC742843-100 1x 100 µL

SIGLEC1 / CD169 / Sialoadhesin (HSn 7D2), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SIAH1 Rabbit Polyclonal Antibody
AP05260SU-N 100 µg

SIAH1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
NCKX2 (SLC24A2) (NM_001193288) Human Over-expression Lysate
LY433861 100 µg

NCKX2 (SLC24A2) (NM_001193288) Human Over-expression Lysate

Sign In for Pricing
View Details
DUT (NM_001948) Human Over-expression Lysate
LC400715 20 µg

DUT (NM_001948) Human Over-expression Lysate

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-01 50 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details
APC Anti-Mouse CD69 Antibody[H1.2F3]
E-AB-F1187E-02 100 Tests

APC Anti-Mouse CD69 Antibody[H1.2F3]

Sign In for Pricing
View Details