Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Reprimo-like protein (RPRML)

This Recombinant Human Reprimo-like protein (RPRML) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

Reprimo-like protein

UniProt

Q8N4K4

Expression Region

1-120

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNATFLNHSGLEEVDGVGGGAGAALGNRTHGLGTWLGCCPGGAPLAASDGVPAGLAPDER SLWVSRVAQIAVLCVLSLTVVFGVFFLGCNLLIKSESMINFLVQERRPSKDVGAAILGLY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Hnf4a Rabbit Polyclonal Antibody
TA377152 100 µL

Hnf4a Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
ADAM8 Human Gene Knockout Kit (CRISPR)
KN213386BN 1 Kit

ADAM8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
TAFA4 (NM_001005527) Human Over-expression Lysate
LY423625 100 µg

TAFA4 (NM_001005527) Human Over-expression Lysate

Sign In for Pricing
View Details
Isopentenyl Pyrophosphate Ammonium Salt-13C2 (Contains ~1eq H3PO4)
TRC-I821853-2.5MG 2.5 mg

Isopentenyl Pyrophosphate Ammonium Salt-13C2 (Contains ~1eq H3PO4)

Sign In for Pricing
View Details
Standard Fume Hood BFSD-304
BFSD-304 1 Unit

Standard Fume Hood BFSD-304

Sign In for Pricing
View Details
Mouse Phosphodiesterase 3B, cGMP Inhibited (PDE3B) ELISA Kit
RDR-PDE3B-Mu-01 96 Tests

Mouse Phosphodiesterase 3B, cGMP Inhibited (PDE3B) ELISA Kit

Sign In for Pricing
View Details