Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2)

This Recombinant Bovine NADH dehydrogenase [ubiquinone] 1 subunit C2 (NDUFC2) spans the amino acid sequence from region 1-120.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 subunit C2, Complex I-B14.5b, CI-B14.5b, NADH-ubiquinone oxidoreductase subunit B14.5b

UniProt

Q02827

Expression Region

1-120

Origin

Bos taurus (Bovine)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MMTGRQGRATFQFLPDEARSLPPPKLTDPRLAFVGFLGYCSGLIDNAIRRRPVLLAGLHR QLLYITSFVFVGYYLLKRQDYMYAVRDHDMFSYIKSHPEDFPEKDKKTYGEVFEEFHPVR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL
BNC740032-100 1x 100 µL

MUC2 (CCP58), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL
BNC040218-100 1x 100 µL

CD100 (Semaphorin-4D) (A8), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL
BNC880029-100 1x 100 µL

Fibronectin (TV-1), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF640R conjugate, 0.1mg/mL
BNC400520-100 1x 100 µL

Mucin 1 / EMA / Episialin / CD227 (MUC1/520), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C-Myc (9E10.3), CF594 conjugate, 0.1mg/mL
BNC940596-500 1x 500 µL

C-Myc (9E10.3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF488A conjugate, 0.1mg/mL
BNC882083-500 1x 500 µL

CD86 (Dendritic Cells Maturation Marker) (rC86/1146), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details