Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb1855 (Mb1855)

This Recombinant Uncharacterized protein Mb1855 (Mb1855) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb1855

UniProt

P64894

Expression Region

1-121

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGSDTAWSPARMIGIAALAVGIVLGLVFHPGVPEVIQPYLPIAVVAALDAVFGGLRAYLE RIFDPKVFVVSFVFNVLVAALIVYVGDQLGVGTQLSTAIIVVLGIRIFGNTAALRRRLFG A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCR3 Antibody
MBS9405347-01 0.1 mL

CCR3 Antibody

Sign In for Pricing
View Details
CCR3 Antibody
MBS9405347-02 5x 0.1 mL

CCR3 Antibody

Sign In for Pricing
View Details
Jak3 Rabbit Polyclonal Antibody (APC)
orb994528 100 µL

Jak3 Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Hydrolyzed Glutenin
TRP-00185-01 1 mg

Hydrolyzed Glutenin

Sign In for Pricing
View Details
Hydrolyzed Glutenin
TRP-00185-02 5 mg

Hydrolyzed Glutenin

Sign In for Pricing
View Details
Mmu-miR-7023-3p miRNA Inhibitor
CIM1518-01 10 nmol

Mmu-miR-7023-3p miRNA Inhibitor

Sign In for Pricing
View Details