Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Shewanella sp. Fumarate reductase subunit D (frdD)

This Recombinant Shewanella sp. Fumarate reductase subunit D (frdD) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Fumarate reductase subunit D

UniProt

A1REF8

Expression Region

1-121

Origin

Shewanella sp. (strain W3-18-1)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MINYSPKRSDEPIWWGLFGAGGVWFAMITPVTVLLMGILLPLHGFGVVDIGYDKVYAFVS HPIGGAFTVLSLSLPMWHAMHRVHHGLHDLQIHLGTVGKYACYLAAALVTVLATVWVIQL S

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL
BNC050017-500 1x 500 µL

Ep-CAM / CD326 (VU-1D9), CF405M conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL
BNC880994-100 1x 100 µL

TNF alpha (J2D10), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL
BNC880146-500 1x 500 µL

CD10 (CB-CALLA), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL
BNC471429-100 1x 100 µL

E-Cadherin / CD324 (Intercellular Junction Marker) (4A2), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD8 (RIV11), CF405S conjugate, 0.1mg/mL
BNC040333-100 1x 100 µL

CD8 (RIV11), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF594 conjugate, 0.1mg/mL
BNC940193-100 1x 100 µL

CD86 (BU63), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details