Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yndK (yndK)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yndK (yndK) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yndK

UniProt

O31814

Expression Region

1-121

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEAN DHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKR K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF488A conjugate, 0.1mg/mL
BNC883256-500 1x 500 µL

E-Cadherin (CDH1) / CD324 (Intercellular Junction Marker) (CDH1/3256), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Plaur Mouse Gene Knockout Kit (CRISPR)
KN313408BN 1 Kit

Plaur Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
(4R)-1-Oxa-6-azaspiro[3.4]octane Hydrochloride
TRC-O632800-50MG 50 mg

(4R)-1-Oxa-6-azaspiro[3.4]octane Hydrochloride

Sign In for Pricing
View Details
6,7-Dichloro-1-ethyl-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester
TRC-D438950-250MG 250 mg

6,7-Dichloro-1-ethyl-1,4-dihydro-4-oxo-3-quinolinecarboxylic Acid Ethyl Ester

Sign In for Pricing
View Details
MALT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]
TA807311BM 100 µL

MALT1 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI3A2]

Sign In for Pricing
View Details
Stanniocalcin 2 / STC-2 Recombinant Rabbit monoclonal Antibody
HA751434 100 µL

Stanniocalcin 2 / STC-2 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details