Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized membrane protein yndK (yndK)

This Recombinant Bacillus subtilis Uncharacterized membrane protein yndK (yndK) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein yndK

UniProt

O31814

Expression Region

1-121

Origin

Bacillus subtilis (strain 168)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MNCFKILHRIKTGKEGFMVFYISLFLILWLAAGFAVGMKQVYVDQLFDKAVIERLEKEAN DHGHADRMIKQRVLYIAAVTVSGFISVYYEMKTIPQRRNIRKIEKNIMKLNQAKKRRMKR K

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

L-2-Nitrophenylalanine
TRC-N502235-50MG 50 mg

L-2-Nitrophenylalanine

Sign In for Pricing
View Details
GIMAP8 Human Gene Knockout Kit (CRISPR)
KN420758 1 Kit

GIMAP8 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
PPM1H (Center) Rabbit Polyclonal Antibody
AP53413PU-N 400 µL

PPM1H (Center) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Human CEP89 activation kit by CRISPRa
GA113754 1 Kit

Human CEP89 activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Spleen
CS505803 5x 5 µm

Frozen Tissue Sections, Spleen

Sign In for Pricing
View Details
Recoverin (RCVRN) (NM_002903) Human Over-expression Lysate
LY419029 100 µg

Recoverin (RCVRN) (NM_002903) Human Over-expression Lysate

Sign In for Pricing
View Details