Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 191C (Tmem191c)

This Recombinant Mouse Transmembrane protein 191C (Tmem191c) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Transmembrane protein 191C

UniProt

Q9JJB1

Expression Region

1-121

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAAAALEATRGGSEPWNSEPRPVQDCAGSLMEEVARADCEKRLFGGTGAGSLRLWALSA LQTLLLLPLGFLVLPLIYVVLAKPDAVGPGLQSLGSDAVFRRLRYTLSPLLELRARGLLP A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC93 3'UTR GFP Stable Cell Line
TU053676 1.0 mL

CCDC93 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
MTERFD1 Antibody
E99804 100 µL

MTERFD1 Antibody

Sign In for Pricing
View Details
Tmem184c Mouse shRNA Plasmid (Locus ID 234463)
TR507080 1 Kit

Tmem184c Mouse shRNA Plasmid (Locus ID 234463)

Sign In for Pricing
View Details
IFluor® 488 Anti-human CD140b Antibody *18A2*
11401050-AAT 100 Tests

IFluor® 488 Anti-human CD140b Antibody *18A2*

Sign In for Pricing
View Details
Zswim2 sgRNA CRISPR Lentivector (Mouse) (Target 3)
K3433304 1.0 µg DNA

Zswim2 sgRNA CRISPR Lentivector (Mouse) (Target 3)

Sign In for Pricing
View Details
Human TXNL4A Protein
orb429048-01 2 µg

Human TXNL4A Protein

Sign In for Pricing
View Details