Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 191C (Tmem191c)

This Recombinant Mouse Transmembrane protein 191C (Tmem191c) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Transmembrane protein 191C

UniProt

Q9JJB1

Expression Region

1-121

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAAAALEATRGGSEPWNSEPRPVQDCAGSLMEEVARADCEKRLFGGTGAGSLRLWALSA LQTLLLLPLGFLVLPLIYVVLAKPDAVGPGLQSLGSDAVFRRLRYTLSPLLELRARGLLP A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse TGFb3 (Transforming Growth Factor Beta 3) ELISA Kit
EK242203 96 Well

Mouse TGFb3 (Transforming Growth Factor Beta 3) ELISA Kit

Sign In for Pricing
View Details
SPON2 (NM_001128325) Human Tagged ORF Clone Lentiviral Particle
RC225482L4V 200 µL

SPON2 (NM_001128325) Human Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Slc13a1 (NM_019481) Mouse Tagged ORF Clone
MR209251 10 µg

Slc13a1 (NM_019481) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Lentiviral mouse Scyl1 shRNA (UAS) - Lentiviral mouse Scyl1 shRNA (UAS, RFP) plasmid
GTR15128881 1 Vial

Lentiviral mouse Scyl1 shRNA (UAS) - Lentiviral mouse Scyl1 shRNA (UAS, RFP) plasmid

Sign In for Pricing
View Details
Phospho-IRAK1 (Thr387) Blocking Peptide
MBS9618972-01 1 mg

Phospho-IRAK1 (Thr387) Blocking Peptide

Sign In for Pricing
View Details
Phospho-IRAK1 (Thr387) Blocking Peptide
MBS9618972-02 5x 1 mg

Phospho-IRAK1 (Thr387) Blocking Peptide

Sign In for Pricing
View Details