Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Transmembrane protein 191C (Tmem191c)

This Recombinant Mouse Transmembrane protein 191C (Tmem191c) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Transmembrane protein 191C

UniProt

Q9JJB1

Expression Region

1-121

Origin

Mus musculus (Mouse)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAAAALEATRGGSEPWNSEPRPVQDCAGSLMEEVARADCEKRLFGGTGAGSLRLWALSA LQTLLLLPLGFLVLPLIYVVLAKPDAVGPGLQSLGSDAVFRRLRYTLSPLLELRARGLLP A

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CEP164 (E-9) Alexa Fluor® 594
sc-515403 AF594 200 µg/mL

CEP164 (E-9) Alexa Fluor® 594

Sign In for Pricing
View Details
CD45RA Antibody
V4764SAF-100UG 100 µg

CD45RA Antibody

Sign In for Pricing
View Details
Heclin
BA6085-10 10 mg

Heclin

Sign In for Pricing
View Details
OR7C2 Antibody
A14937-50UG 50 µg

OR7C2 Antibody

Sign In for Pricing
View Details
LOC100042923 shRNA Plasmid (m)
sc-148168-SH 20 µg

LOC100042923 shRNA Plasmid (m)

Sign In for Pricing
View Details
Rabbit Anti-Mouse Integrin Alpha M (CD11b) Polyclonal Antibody
VD3N169 1 Each

Rabbit Anti-Mouse Integrin Alpha M (CD11b) Polyclonal Antibody

Sign In for Pricing
View Details