Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Lectin-like protein BA14k (BMEII0552)

This Recombinant Brucella melitensis biotype 1 Lectin-like protein BA14k (BMEII0552) spans the amino acid sequence from region 27-147.

Product Specifications

Product Name Alternative

Lectin-like protein BA14k

UniProt

Q7CNS4

Expression Region

27-147

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Oxelumab Biosimilar - Dylight488 Research Grade
ICH5187D488-0.1mg 100 µg

Oxelumab Biosimilar - Dylight488 Research Grade

Sign In for Pricing
View Details
Engler Viscometer BPTL-106
BPTL-106 1 Unit

Engler Viscometer BPTL-106

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011G-01 50 Tests

PE/Cyanine5 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011G-02 100 Tests

PE/Cyanine5 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
PE/Cyanine5 Anti-Mouse CD62L Antibody[MEL-14]
E-AB-F1011G-03 2x 100 Tests

PE/Cyanine5 Anti-Mouse CD62L Antibody[MEL-14]

Sign In for Pricing
View Details
Ricinolic Acid (~80%)
TRC-R495600-1G 1 g

Ricinolic Acid (~80%)

Sign In for Pricing
View Details