Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Brucella melitensis biotype 1 Lectin-like protein BA14k (BMEII0552)

This Recombinant Brucella melitensis biotype 1 Lectin-like protein BA14k (BMEII0552) spans the amino acid sequence from region 27-147.

Product Specifications

Product Name Alternative

Lectin-like protein BA14k

UniProt

Q7CNS4

Expression Region

27-147

Origin

Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

APMNMDRPAINQNVIQARAHYRPQNYNRGHRPGYWHGHRGYRHYRHGYRRHNDGWWYPLA AFGAGAIIGGAISQPRPVYRAPAGSPHVQWCYSRYKSYRASDNTFQPYNGPRKQCRSPYS R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mitochondrial Marker (AE-1), 0.2mg/mL
BNUB0905-500 1x 500 µL

Mitochondrial Marker (AE-1), 0.2mg/mL

Sign In for Pricing
View Details
2,3,3-Trichloro-2-propenesulfonic Acid Sodium Salt
TRC-T797900-10MG 10 mg

2,3,3-Trichloro-2-propenesulfonic Acid Sodium Salt

Sign In for Pricing
View Details
CYBA Human Gene Knockout Kit (CRISPR)
KN400706 1 Kit

CYBA Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
3,4-Ethylenedioxybenzoic Acid
TRC-E917795-25G 25 g

3,4-Ethylenedioxybenzoic Acid

Sign In for Pricing
View Details
TCP1 theta (CCT8) (NM_006585) Human Recombinant Protein
TP310044L 1 mg

TCP1 theta (CCT8) (NM_006585) Human Recombinant Protein

Sign In for Pricing
View Details
Cephradine-d5
TRC-C261802-1MG 1 mg

Cephradine-d5

Sign In for Pricing
View Details