Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Uncharacterized protein C10orf35 (C10orf35)

This Recombinant Human Uncharacterized protein C10orf35 (C10orf35) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Uncharacterized protein C10orf35

UniProt

Q96D05

Expression Region

1-121

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MVRILANGEIVQDDDPRVRTTTQPPRGSIPRQSFFNRGHGAPPGGPGPRQQQAGARLGAA QSPFNDLNRQLVNMGFPQWHLGNHAVEPVTSILLLFLLMMLGVRGLLLVGLVYLVSHLSQ R

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HIV-1-IN-87
HY-178031 1 Each

HIV-1-IN-87

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)
MBS2164278-01 0.1 mL

PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)
MBS2164278-02 0.2 mL

PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)
MBS2164278-03 0.5 mL

PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)
MBS2164278-04 1 mL

PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)

Sign In for Pricing
View Details
PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)
MBS2164278-05 5 mL

PE-Linked Monoclonal Antibody to Chloride Channel Accessory 1 (CLCA1)

Sign In for Pricing
View Details