Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 191C (TMEM191C)

This Recombinant Human Transmembrane protein 191C (TMEM191C) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Transmembrane protein 191C

UniProt

A6NGB0

Expression Region

1-121

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAAEELDAWQSGRELCDGQLRGVQYSTESLMEEMARADRETRLFGGPRALAIRRCVLGA LQVLLTLPLLFLGLSLLWTVLLDPGAVSAWLWSLTSETTLRRLRYTLSPLLELRANGLLP T

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

RGD1563104 (NM_001106967) Rat Untagged Clone
RN212759 10 µg

RGD1563104 (NM_001106967) Rat Untagged Clone

Sign In for Pricing
View Details
Patecibart Biosimilar - Research Grade
ICH5264-100mg 100 mg

Patecibart Biosimilar - Research Grade

Sign In for Pricing
View Details
ARID5A Rabbit Polyclonal Antibody (APC)
orb2602321 100 µg

ARID5A Rabbit Polyclonal Antibody (APC)

Sign In for Pricing
View Details
Acss1 (BC030930) Mouse Tagged Lenti ORF Clone
MR206638L3 10 µg

Acss1 (BC030930) Mouse Tagged Lenti ORF Clone

Sign In for Pricing
View Details
Apaf-1, NT (Apoptosis Protease Activating Factor-1)
A2298-65 100 µg

Apaf-1, NT (Apoptosis Protease Activating Factor-1)

Sign In for Pricing
View Details
LOC632026 Mouse siRNA Oligo Duplex (Locus ID 632026)
SR402672 1 Kit

LOC632026 Mouse siRNA Oligo Duplex (Locus ID 632026)

Sign In for Pricing
View Details