Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transmembrane protein 191C (TMEM191C)

This Recombinant Human Transmembrane protein 191C (TMEM191C) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Transmembrane protein 191C

UniProt

A6NGB0

Expression Region

1-121

Origin

Homo sapiens (Human)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MEAAEELDAWQSGRELCDGQLRGVQYSTESLMEEMARADRETRLFGGPRALAIRRCVLGA LQVLLTLPLLFLGLSLLWTVLLDPGAVSAWLWSLTSETTLRRLRYTLSPLLELRANGLLP T

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

TDRD9 polyclonal antibody
orb1719990-01 50 µL

TDRD9 polyclonal antibody

Sign In for Pricing
View Details
TDRD9 polyclonal antibody
orb1719990-02 100 µL

TDRD9 polyclonal antibody

Sign In for Pricing
View Details
Mouse Il22ra2 ELISA KIT
ELI-14295m 96 Tests

Mouse Il22ra2 ELISA KIT

Sign In for Pricing
View Details
Lentiviral mouse Gdpgp1 shRNA (UAS) - Lentiviral mouse Gdpgp1 shRNA (UAS) (100)
GTR15257394 1 Vial

Lentiviral mouse Gdpgp1 shRNA (UAS) - Lentiviral mouse Gdpgp1 shRNA (UAS) (100)

Sign In for Pricing
View Details
BLVRA CRISPRa sgRNA lentivector (set of three targets)(Mouse)
13348124 3x 1.0µg DNA

BLVRA CRISPRa sgRNA lentivector (set of three targets)(Mouse)

Sign In for Pricing
View Details
Mouse Monoclonal LAG-3 Antibody (11E3) [DyLight 650]
NBP1-97662C 0.1 mL

Mouse Monoclonal LAG-3 Antibody (11E3) [DyLight 650]

Sign In for Pricing
View Details