Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Small basic protein (sbp)

This Recombinant Bacillus subtilis Small basic protein (sbp) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Small basic protein

UniProt

P28265

Expression Region

1-121

Origin

Bacillus subtilis (strain 168)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV I

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal Sars Membrane Protein Antibody [DyLight 488]
NBP2-41059G 0.1 mL

Rabbit Polyclonal Sars Membrane Protein Antibody [DyLight 488]

Sign In for Pricing
View Details
Human Crystallin Mu (CRYm) ELISA Kit
QY-E02746 96 Tests

Human Crystallin Mu (CRYm) ELISA Kit

Sign In for Pricing
View Details
CD177 Lentiviral Activation Particles (m)
sc-427218-LAC 200 µL

CD177 Lentiviral Activation Particles (m)

Sign In for Pricing
View Details
Human Growth Factor Receptor Bound Protein 10 (Grb10) ELISA Kit
DLR-Grb10-Hu-48T 48 Tests

Human Growth Factor Receptor Bound Protein 10 (Grb10) ELISA Kit

Sign In for Pricing
View Details
Eci3 Protein Lysate (Rat) with C-HA Tag
18897036 100 µg

Eci3 Protein Lysate (Rat) with C-HA Tag

Sign In for Pricing
View Details
FRMPD2 CytoSection
TS412838P5 25 Slides

FRMPD2 CytoSection

Sign In for Pricing
View Details