Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Small basic protein (sbp)

This Recombinant Bacillus subtilis Small basic protein (sbp) spans the amino acid sequence from region 1-121.

Product Specifications

Product Name Alternative

Small basic protein

UniProt

P28265

Expression Region

1-121

Origin

Bacillus subtilis (strain 168)

Field of Research

Neuroscience

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MWLPVLGLVLGIAIGLMTNLTIPSEYSNYLSLAVLAALDTLIGGIRAHLQGTYDEMVFVS GFFFNIILAISLAFLGVHLGVDLYLAGIFAFGVRLFQNIAVIRRNLLTKWTLSKKNKKNV I

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lentiviral mouse Pcdhb20 shRNA (UAS) - Lentiviral mouse Pcdhb20 shRNA (UAS) plasmid
GTR15132799 1 Vial

Lentiviral mouse Pcdhb20 shRNA (UAS) - Lentiviral mouse Pcdhb20 shRNA (UAS) plasmid

Sign In for Pricing
View Details
(3β,5β,12α)-3,12-Dihydroxycholan-24-oic Acid
TRC-D251110-25MG 25 mg

(3β,5β,12α)-3,12-Dihydroxycholan-24-oic Acid

Sign In for Pricing
View Details
Sheep Polyclonal Sheep anti-Human Lambda Light Chain Secondary Antibody [DyLight 594]
NB7482DL594 1 mL

Sheep Polyclonal Sheep anti-Human Lambda Light Chain Secondary Antibody [DyLight 594]

Sign In for Pricing
View Details
Recombinant Mouse Mucin-6 (Muc6) , partial
MBS1315727-01 0.05 mg (E-Coli)

Recombinant Mouse Mucin-6 (Muc6) , partial

Sign In for Pricing
View Details
Recombinant Mouse Mucin-6 (Muc6) , partial
MBS1315727-02 0.2 mg (E-Coli)

Recombinant Mouse Mucin-6 (Muc6) , partial

Sign In for Pricing
View Details
Recombinant Mouse Mucin-6 (Muc6) , partial
MBS1315727-03 0.05 mg (Yeast)

Recombinant Mouse Mucin-6 (Muc6) , partial

Sign In for Pricing
View Details