Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Uncharacterized protein Mb2295 (Mb2295)

This Recombinant Uncharacterized protein Mb2295 (Mb2295) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Uncharacterized protein Mb2295

UniProt

P64970

Expression Region

1-122

Origin

Mycobacterium bovis

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MADDSNDTATDVEPDYRFTLANERTFLAWQRTALGLLAAAVALVQLVPELTIPGARQVLG VVLAILAILTSGMGLLRWQQADRAMRRHLPLPRHPTPGYLAVGLCVVGVVALALVVAKAI TG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

H-Ser-Tyr-OH
MBS5818525 Inquire

H-Ser-Tyr-OH

Sign In for Pricing
View Details
HSPA5 (Heat Shock 70kD Protein 5 (Glucose-Regulated Protein, 78kD), BIP, FLJ26106, GRP78, MIF2) (MaxLight 650)
MBS6228096-01 0.1 mL

HSPA5 (Heat Shock 70kD Protein 5 (Glucose-Regulated Protein, 78kD), BIP, FLJ26106, GRP78, MIF2) (MaxLight 650)

Sign In for Pricing
View Details
HSPA5 (Heat Shock 70kD Protein 5 (Glucose-Regulated Protein, 78kD), BIP, FLJ26106, GRP78, MIF2) (MaxLight 650)
MBS6228096-02 5x 0.1 mL

HSPA5 (Heat Shock 70kD Protein 5 (Glucose-Regulated Protein, 78kD), BIP, FLJ26106, GRP78, MIF2) (MaxLight 650)

Sign In for Pricing
View Details
Benzyl 3- (Hydroxymethyl) -8-azabicyclo[3.2.1]octane-8-carboxylate
442451-01 25 mg

Benzyl 3- (Hydroxymethyl) -8-azabicyclo[3.2.1]octane-8-carboxylate

Sign In for Pricing
View Details
Benzyl 3- (Hydroxymethyl) -8-azabicyclo[3.2.1]octane-8-carboxylate
442451-02 50 mg

Benzyl 3- (Hydroxymethyl) -8-azabicyclo[3.2.1]octane-8-carboxylate

Sign In for Pricing
View Details
Tris (2-chloroethyl) phosphate-D12
DE991 1 Each

Tris (2-chloroethyl) phosphate-D12

Sign In for Pricing
View Details