Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0657 (AF_0657)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0657 (AF_0657) spans the amino acid sequence from region 24-145.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0657

UniProt

O29600

Expression Region

24-145

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EDEIVTVEGWLTYYDEEKKSWIPLERAQVTIYVDGREVGKAETNEYGMFTFAFPAPYKGR HKLEVRFKGKAGYESSSKSLDFQVMEREQKLKLGRLARDVLLLIIALVFLLFVAIFITNM LR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1254 Recombinant Protein (Mouse)
RP156533 100 µg

Olfr1254 Recombinant Protein (Mouse)

Sign In for Pricing
View Details
SLC30A5 3'UTR Lenti-reporter-Luc Vector
44114081 1.0 µg

SLC30A5 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Nrf2 K599 Rabbit Polyclonal Antibody
E53P06470 100 µL

Nrf2 K599 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
C2 Knockout SK-HEP-1 Polyclonal Cells
ARG41335 1 Million

C2 Knockout SK-HEP-1 Polyclonal Cells

Sign In for Pricing
View Details
TAMRA azide, 5-isomer, 25 mg
D7130 25 mg

TAMRA azide, 5-isomer, 25 mg

Sign In for Pricing
View Details
Ecabet sodium 10mg
A14028-10 10 mg

Ecabet sodium 10mg

Sign In for Pricing
View Details