Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0657 (AF_0657)

This Recombinant Archaeoglobus fulgidus Uncharacterized protein AF_0657 (AF_0657) spans the amino acid sequence from region 24-145.

Product Specifications

Product Name Alternative

Uncharacterized protein AF_0657

UniProt

O29600

Expression Region

24-145

Origin

Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

EDEIVTVEGWLTYYDEEKKSWIPLERAQVTIYVDGREVGKAETNEYGMFTFAFPAPYKGR HKLEVRFKGKAGYESSSKSLDFQVMEREQKLKLGRLARDVLLLIIALVFLLFVAIFITNM LR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD19 Fc Chimera, Human
Z03407-50 50 µg

CD19 Fc Chimera, Human

Sign In for Pricing
View Details
Human Prostate Stem Cell Antigen (PSCA) ELISA Kit
MBS2704641-01 24 Strip Well

Human Prostate Stem Cell Antigen (PSCA) ELISA Kit

Sign In for Pricing
View Details
Human Prostate Stem Cell Antigen (PSCA) ELISA Kit
MBS2704641-02 48 Well

Human Prostate Stem Cell Antigen (PSCA) ELISA Kit

Sign In for Pricing
View Details
Human Prostate Stem Cell Antigen (PSCA) ELISA Kit
MBS2704641-03 96 Well

Human Prostate Stem Cell Antigen (PSCA) ELISA Kit

Sign In for Pricing
View Details
Human Prostate Stem Cell Antigen (PSCA) ELISA Kit
MBS2704641-04 5x 96 Well

Human Prostate Stem Cell Antigen (PSCA) ELISA Kit

Sign In for Pricing
View Details
Human Prostate Stem Cell Antigen (PSCA) ELISA Kit
MBS2704641-05 10x 96 Well

Human Prostate Stem Cell Antigen (PSCA) ELISA Kit

Sign In for Pricing
View Details