Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2)

This Recombinant Schizosaccharomyces pombe Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2 (ost2) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Probable dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit ost2, EC= 2.4.1.119, Oligosaccharyl transferase 16 kDa subunit, Oligosaccharyl transferase subunit epsilon

UniProt

O14238

Expression Region

1-122

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSSKSGLFLPLSSVITSYNENTNLSLKTIDAFLGFLVVVGGLQFGYALLVGTYPFNSFLS GFISCVGQFVITVGFRMALTQQELQSSSSKKKSPVVSPYKRAFLEFCFSSLVLHFFAVNF LG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL
BNC400176-500 1x 500 µL

CD5 (Cris-1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Mucin 6 (MUC6) (CLH5), CF647 conjugate, 0.1mg/mL
BNC470891-100 1x 100 µL

Mucin 6 (MUC6) (CLH5), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF640R conjugate, 0.1mg/mL
BNC402883-100 1x 100 µL

Topoisomerase I, Mitochondrial (TOP1MT) (TOP1MT/2883R), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
C1QA / Complement C1q A-Chain (C1QA/2953), CF488A conjugate, 0.1mg/mL
BNC882953-100 1x 100 µL

C1QA / Complement C1q A-Chain (C1QA/2953), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HER-2 / CD340 (ERB2/776), CF594 conjugate, 0.1mg/mL
BNC940776-500 1x 500 µL

HER-2 / CD340 (ERB2/776), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
P53 Tumor Suppressor Protein (TP53/1739), CF647 conjugate, 0.1mg/mL
BNC471739-100 1x 100 µL

P53 Tumor Suppressor Protein (TP53/1739), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details