Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.06c (SPCC622.06c)

This Recombinant Schizosaccharomyces pombe Putative uncharacterized membrane protein C622.06c (SPCC622.06c) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Putative uncharacterized membrane protein C622.06c

UniProt

O94596

Expression Region

1-122

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSPKESIELQEFQSLLQDEAYEELINKKTYEAIKYRSNDGILPIIITLFIFSFVISRMII FFISLFNKNTYCELPAVADAIINSIALVCIIVILYFSSRKLNVEIRRGEVEDYRANLERN QR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HS3ST2 Human qPCR Primer Pair (NM_006043)
HP209062 200 Reactions

HS3ST2 Human qPCR Primer Pair (NM_006043)

Sign In for Pricing
View Details
LINC00167 Protein Vector (Human) (pPM-C-HA)
26589021 500 ng

LINC00167 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details
HRASLS3 (PLA2G16) Mouse Monoclonal Antibody [Clone ID: OTI1E9]
TA506967 100 µL

HRASLS3 (PLA2G16) Mouse Monoclonal Antibody [Clone ID: OTI1E9]

Sign In for Pricing
View Details
Goat Alpha (1,3) fucosyltransferase (FUT7) ELISA kit
GTR10409838 96 Well

Goat Alpha (1,3) fucosyltransferase (FUT7) ELISA kit

Sign In for Pricing
View Details
GK2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)
LV628369 1.0 µg DNA

GK2 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV)

Sign In for Pricing
View Details
Mouse Trp53cor1 Pre-designed siRNA Set A
SI115297A 1 Each

Mouse Trp53cor1 Pre-designed siRNA Set A

Sign In for Pricing
View Details