Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Cricetulus griseus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11)

This Recombinant Cricetulus griseus NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (NDUFB11) spans the amino acid sequence from region 30-151.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, Complex I-ESSS, CI-ESSS, NADH-ubiquinone oxidoreductase ESSS subunit

UniProt

Q6DQX6

Expression Region

30-151

Origin

Cricetulus griseus (Chinese hamster) (Cricetulus barabensis griseus)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESSRAVISPSTVERKRQRQPTMHWQEDPESEDENVYAKNPDFHGYDQDPVVDVWNMRVVF FFGFSIVLVLGTTFMAYLPDYRMQEWARREAERLVKYREANGLPIMESNCFDPSKIQLPE DE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

MIR346 Rat qPCR Template Standard (MI0000633)
RK300209 200 Reactions

MIR346 Rat qPCR Template Standard (MI0000633)

Sign In for Pricing
View Details
E3 Ubiquitin-Protein Ligase Itchy Homolog (ITCH) Antibody
abx456829-01 50 µg

E3 Ubiquitin-Protein Ligase Itchy Homolog (ITCH) Antibody

Sign In for Pricing
View Details
E3 Ubiquitin-Protein Ligase Itchy Homolog (ITCH) Antibody
abx456829-02 100 µg

E3 Ubiquitin-Protein Ligase Itchy Homolog (ITCH) Antibody

Sign In for Pricing
View Details
Flotillin 1 (FLOT1) Rabbit Polyclonal Antibody
TA338139 100 µL

Flotillin 1 (FLOT1) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
KRT7, NT (KRT7, SCL, Keratin, type II cytoskeletal 7, Cytokeratin-7, Keratin-7, Sarcolectin, Type-II keratin Kb7) (MaxLight 750) discontinued
037627-ML750 100 µL

KRT7, NT (KRT7, SCL, Keratin, type II cytoskeletal 7, Cytokeratin-7, Keratin-7, Sarcolectin, Type-II keratin Kb7) (MaxLight 750) discontinued

Sign In for Pricing
View Details
ZNF830 Protein Vector (Human) (pPM-C-HA)
PV048339 500 ng

ZNF830 Protein Vector (Human) (pPM-C-HA)

Sign In for Pricing
View Details