Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C21C3.06 (SPBC21C3.06)

This Recombinant Schizosaccharomyces pombe Uncharacterized membrane protein C21C3.06 (SPBC21C3.06) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Uncharacterized membrane protein C21C3.06

UniProt

Q9P7L7

Expression Region

1-122

Origin

Schizosaccharomyces pombe (strain 972 / ATCC 24843) (Fission yeast)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAFDKLANVATVDAIFAISSSTFLWSTWVLQRTILKRPNFFSPNPVVEKMVHPTLITWKL FSFTSVLTVSTFTFASCLIMRTIGVENIKEFGLYAREKLSFARAKPVKDDITSFPNHKIS IT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL
BNC881035-500 1x 500 µL

CD8 (C8/1035), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL
BNC880178-500 1x 500 µL

CD50 (ICAM-3) (186-2G9), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL
BNC740965-100 1x 100 µL

MUC1 / CA15-3 / EMA / CD227 (Epithelial Marker) (VU-11D1), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TGFalpha (TG86), CF568 conjugate, 0.1mg/mL
BNC680786-500 1x 500 µL

TGFalpha (TG86), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD3e, Mouse (145-2C11), CF647 conjugate, 0.1mg/mL
BNC472013-500 1x 500 µL

CD3e, Mouse (145-2C11), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF647 conjugate, 0.1mg/mL
BNC472894-100 1x 100 µL

Spectrin beta III (SPTBN2) (SPTBN2/2894R), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details