Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (Ndufb11)

This Recombinant Mouse NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial (Ndufb11) spans the amino acid sequence from region 30-151.

Product Specifications

Product Name Alternative

NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial, Complex I-ESSS, CI-ESSS, NADH-ubiquinone oxidoreductase ESSS subunit, Neuronal protein 15.6

UniProt

O09111

Expression Region

30-151

Origin

Mus musculus (Mouse)

Field of Research

Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ESSRAVIAPSGVEKKRQREPTMQWQEDPEPEDENVYAKNPDFHGYDSDPVVDVWNMRAVF FFGFSIVLVFGTTFVAYVPDYRMQEWARREAERLVKYREVNGLPIMESNYFDPSKIQLPE DD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human TARS (Threonyl tRNA Synthetase, cytoplasmic) ELISA Kit
EH3852 96 Tests

Human TARS (Threonyl tRNA Synthetase, cytoplasmic) ELISA Kit

Sign In for Pricing
View Details
Human Thioredoxin domain containing protein 5
GTR10430621 96 Well

Human Thioredoxin domain containing protein 5

Sign In for Pricing
View Details
(rel) -Myrislignan
T13863-01 25 mg

(rel) -Myrislignan

Sign In for Pricing
View Details
(rel) -Myrislignan
T13863-02 50 mg

(rel) -Myrislignan

Sign In for Pricing
View Details
(rel) -Myrislignan
T13863-03 100 mg

(rel) -Myrislignan

Sign In for Pricing
View Details
Mouse GDF3 (Growth Differentiation Factor 3) ELISA Kit
EM1066 96 Tests

Mouse GDF3 (Growth Differentiation Factor 3) ELISA Kit

Sign In for Pricing
View Details