Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.2 (MJ0226.2)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.2 (MJ0226.2) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0226.2

UniProt

P81305

Expression Region

1-122

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTMNVVGLAIYLYAGFLSFIFGFISLYAFIKYSKLERKNKEIIYVYVDNLKNFSPYMFY SILLTFTIVFVIFALFICFVFNFDLYLGLTMLFSYFLIIYLFCFKKYRVEIYKDGFYGVF QN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(R)-3-(4-Phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine-d4
TRC-P318772-25MG 25 mg

(R)-3-(4-Phenoxyphenyl)-1-(piperidin-3-yl)-1H-pyrazolo[3,4-d]pyrimidin-4-amine-d4

Sign In for Pricing
View Details
Recombinant Human PFKFB1 Protein (His Tag)
PKSH032459-01 10 µg

Recombinant Human PFKFB1 Protein (His Tag)

Sign In for Pricing
View Details
Recombinant Human PFKFB1 Protein (His Tag)
PKSH032459-02 50 µg

Recombinant Human PFKFB1 Protein (His Tag)

Sign In for Pricing
View Details
CRMP1 (NM_001313) Human Over-expression Lysate
LY400522 100 µg

CRMP1 (NM_001313) Human Over-expression Lysate

Sign In for Pricing
View Details
SOX3 Rabbit Polyclonal Antibody
TA367379 100 µL

SOX3 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Deoxy-D-erythro-hexos-2-ulose-bis-benzoylhydrazone
TRC-D232900-500MG 500 mg

3-Deoxy-D-erythro-hexos-2-ulose-bis-benzoylhydrazone

Sign In for Pricing
View Details