Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.2 (MJ0226.2)

This Recombinant Methanocaldococcus jannaschii Uncharacterized protein MJ0226.2 (MJ0226.2) spans the amino acid sequence from region 1-122.

Product Specifications

Product Name Alternative

Uncharacterized protein MJ0226.2

UniProt

P81305

Expression Region

1-122

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MGTMNVVGLAIYLYAGFLSFIFGFISLYAFIKYSKLERKNKEIIYVYVDNLKNFSPYMFY SILLTFTIVFVIFALFICFVFNFDLYLGLTMLFSYFLIIYLFCFKKYRVEIYKDGFYGVF QN

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

6-HEX azide
240-AAT 5 mg

6-HEX azide

Sign In for Pricing
View Details
D-Ribonolactone 2,3-Cyclohexyl Ketal
TRC-R416005-250MG 250 mg

D-Ribonolactone 2,3-Cyclohexyl Ketal

Sign In for Pricing
View Details
Fmoc-Cys (StBu) Wang Resin
H0751501309.1G 1 g

Fmoc-Cys (StBu) Wang Resin

Sign In for Pricing
View Details
Human C1orf227 (SPATA45) activation kit by CRISPRa
GA115719 1 Kit

Human C1orf227 (SPATA45) activation kit by CRISPRa

Sign In for Pricing
View Details
ScavengePore Benzyltriethylammonium chloride, moist resin
SC11012.10G 10 g

ScavengePore Benzyltriethylammonium chloride, moist resin

Sign In for Pricing
View Details
MNI-caged-L-glutamate
TRC-M425500-50MG 50 mg

MNI-caged-L-glutamate

Sign In for Pricing
View Details