Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Lactobacillus casei Large-conductance mechanosensitive channel (mscL)

This Recombinant Lactobacillus casei Large-conductance mechanosensitive channel (mscL) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Large-conductance mechanosensitive channel

UniProt

B3WAS8

Expression Region

1-123

Origin

Lactobacillus casei (strain BL23)

Field of Research

Signal Transduction

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLKEFQKFIMRGNVLDLAVGVIIGSAFTGLVTSLTKNLINPILSMFAGKADLSGLYFTIL GAKFTYGNFINDVLNFLIIAFVVFLLVKGINRILPSKPAKPAGPTQEELLTEIRDLLKQD QQV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL
BNC470257-100 1x 100 µL

Cytokeratin, HMW (AE-3), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL
BNC471073-100 1x 100 µL

HLA-Aw32 & HLA-A25 (MHC I) (CATA-1), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF568 conjugate, 0.1mg/mL
BNC680193-100 1x 100 µL

CD86 (BU63), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Prolactin Receptor (B6.2 + PRLR742), CF647 conjugate, 0.1mg/mL
BNC470744-500 1x 500 µL

Prolactin Receptor (B6.2 + PRLR742), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD44 / HCAM Std. (HCAM/2875R), CF568 conjugate, 0.1mg/mL
BNC682875-500 1x 500 µL

CD44 / HCAM Std. (HCAM/2875R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL
BNC741828-500 1x 500 µL

CD30 / TNFRSF8 (Hodgkin & Reed-Sternberg Cell Marker) (rKi-1/779), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details