Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 4 (qoxD)

This Recombinant Bacillus subtilis subsp. spizizenii Quinol oxidase subunit 4 (qoxD) spans the amino acid sequence from region 2-124.

Product Specifications

Product Name Alternative

Quinol oxidase subunit 4, EC= 1.10.3.-, Quinol oxidase aa3-600, subunit qoxD, Quinol oxidase polypeptide IV

UniProt

E0TW64

Expression Region

2-124

Origin

Bacillus subtilis subsp. spizizenii (strain ATCC 23059 / NRRL B-14472 / W23)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

ANKSAEHSHFPWKHIVGFALSIVLTLLALWVAVYTDLSSSAKLWIIFGFAFIQAALQLLM FMHMTESENGGIQVGNTLFGFFGAIVIVLGSIWIFAAHYHHGDHMDGNPPGGAEHSEHSG HNE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL
BNC680781-100 1x 100 µL

Carbonic Anhydrase IX (CA9/781), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL
BNC400461-500 1x 500 µL

Chromogranin A (PHE5), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF568 conjugate, 0.1mg/mL
BNC681853-100 1x 100 µL

TTF-1 / NKX2.1 (Thyroid & Lung Epithelial Marker) (rNX2.1/690), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 7 (KRT7/760), CF568 conjugate, 0.1mg/mL
BNC680760-500 1x 500 µL

Cytokeratin 7 (KRT7/760), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL
BNC471017-100 1x 100 µL

SOX10 (SOX10/1074), CF647 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF405S conjugate, 0.1mg/mL
BNC042600-500 1x 500 µL

EGFRvIII (Epidermal Growth Factor Receptor, Variant III) (GFR/2600R), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details