Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Uncharacterized protein yugM (yugM)

This Recombinant Bacillus subtilis Uncharacterized protein yugM (yugM) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Uncharacterized protein yugM

UniProt

O05245

Expression Region

1-123

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MFMKQLVKHLIIAGFSAAILSFLISFDAVYTGFSSSFGGTLSHFFIHSFLLIGLPLALFT DAVHRILHLKRTHTLFTKLGLYATVVYVSWDSAVWLAAAMAVYFLIECAFFPVGRAKETT ISM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cytokeratin, HMW (34BE12), CF740 conjugate, 0.1mg/mL
BNC740446-100 1x 100 µL

Cytokeratin, HMW (34BE12), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) ELISA Kit
E-EL-H0178-01 24 Tests

Human COL4 (Collagen Type IV) ELISA Kit

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) ELISA Kit
E-EL-H0178-02 48 Tests

Human COL4 (Collagen Type IV) ELISA Kit

Sign In for Pricing
View Details
Human COL4 (Collagen Type IV) ELISA Kit
E-EL-H0178-03 96 Tests

Human COL4 (Collagen Type IV) ELISA Kit

Sign In for Pricing
View Details
C19orf34 (NM_152771) Human Recombinant Protein
TP306937 20 µg

C19orf34 (NM_152771) Human Recombinant Protein

Sign In for Pricing
View Details
GRID2 (NM_001510) Human Over-expression Lysate
LY419892 100 µg

GRID2 (NM_001510) Human Over-expression Lysate

Sign In for Pricing
View Details