Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Methanocaldococcus jannaschii Putative ABC transporter permease protein MJ0877 (MJ0877)

This Recombinant Methanocaldococcus jannaschii Putative ABC transporter permease protein MJ0877 (MJ0877) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Putative ABC transporter permease protein MJ0877

UniProt

Q58287

Expression Region

1-123

Origin

Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) (Methanococcus jannaschii)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MDANLLGEKYAISVGVDIKSLRMWLIILSCVLTATVVAFTGPIAFVGITCPILARMICGT SKHIYVIPVTMLLGAVFLVVADILTRPGVLISSTNVLPLLCPLSIIGAPIAIIIYLKIRK MGI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit Polyclonal GLIPR1L2 Antibody [DyLight 488]
NBP2-82092G 0.1 mL

Rabbit Polyclonal GLIPR1L2 Antibody [DyLight 488]

Sign In for Pricing
View Details
Porcine Platelet Factor 3 PF3 ELISA Kit
BG-POR11919 1 Each

Porcine Platelet Factor 3 PF3 ELISA Kit

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)
MBS1044910-01 0.02 mg (E-Coli)

Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)
MBS1044910-02 0.1 mg (E-Coli)

Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)
MBS1044910-03 0.02 mg (Yeast)

Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)

Sign In for Pricing
View Details
Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)
MBS1044910-04 0.1 mg (Yeast)

Recombinant Enterobacteria phage T4 Tail fiber protein p36 (36)

Sign In for Pricing
View Details