Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 2 (crcB2)

This Recombinant Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q67S16

Expression Region

1-123

Origin

Symbiobacterium thermophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVAAGGALGAWARHGLGSWLTALLPSTFPLPTLMINVLGALLLGFVAGYGIERGRLPE AWRLPVTVGFIGSFTTFSTWSVDTVLLLDAGRWPLALANVGISLAVGLAAVWVGRRLAFR WRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Acp5 activation kit by CRISPRa
GA200029 1 Kit

Mouse Acp5 activation kit by CRISPRa

Sign In for Pricing
View Details
MBNL3 (NM_018388) Human Recombinant Protein
TP316043 20 µg

MBNL3 (NM_018388) Human Recombinant Protein

Sign In for Pricing
View Details
Ep-CAM / CD326 (323/A3), CF488A conjugate, 0.1mg/mL
BNC880396-500 1x 500 µL

Ep-CAM / CD326 (323/A3), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tipiracil Hydrochloride
TRC-T444890-5MG 5 mg

Tipiracil Hydrochloride

Sign In for Pricing
View Details
Hippuric Acid Sodium Salt
TRC-H347013-250MG 250 mg

Hippuric Acid Sodium Salt

Sign In for Pricing
View Details
Glycophorin A (GYPA) Rabbit Polyclonal Antibody
AP31671PU-N 250 µg

Glycophorin A (GYPA) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details