Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 2 (crcB2)

This Recombinant Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q67S16

Expression Region

1-123

Origin

Symbiobacterium thermophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVAAGGALGAWARHGLGSWLTALLPSTFPLPTLMINVLGALLLGFVAGYGIERGRLPE AWRLPVTVGFIGSFTTFSTWSVDTVLLLDAGRWPLALANVGISLAVGLAAVWVGRRLAFR WRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Ethyl 2-(1H-Pyrrol-2-yl)acetate
TRC-E926928-250MG 250 mg

Ethyl 2-(1H-Pyrrol-2-yl)acetate

Sign In for Pricing
View Details
Human Herpes Virus 8 (HHV8) (LN53), Biotin conjugate, 0.1mg/mL
BNCB1746-100 1x 100 µL

Human Herpes Virus 8 (HHV8) (LN53), Biotin conjugate, 0.1mg/mL

Sign In for Pricing
View Details
N~2~,N~2~-Diallyl-1,3,5-triazine-2,4,6-triamine
TRC-B412933-500MG 500 mg

N~2~,N~2~-Diallyl-1,3,5-triazine-2,4,6-triamine

Sign In for Pricing
View Details
Recombinant Cathepsin H Antibody
RC-16569-01 50 μL

Recombinant Cathepsin H Antibody

Sign In for Pricing
View Details
Recombinant Cathepsin H Antibody
RC-16569-02 100 µL

Recombinant Cathepsin H Antibody

Sign In for Pricing
View Details
Recombinant Cathepsin H Antibody
RC-16569-03 1 mL

Recombinant Cathepsin H Antibody

Sign In for Pricing
View Details