Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Protein CrcB homolog 2 (crcB2)

This Recombinant Protein CrcB homolog 2 (crcB2) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Protein CrcB homolog 2

UniProt

Q67S16

Expression Region

1-123

Origin

Symbiobacterium thermophilum

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MAGVAAGGALGAWARHGLGSWLTALLPSTFPLPTLMINVLGALLLGFVAGYGIERGRLPE AWRLPVTVGFIGSFTTFSTWSVDTVLLLDAGRWPLALANVGISLAVGLAAVWVGRRLAFR WRV

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Stability Test Chamber BTST-1504
BTST-1504 1 Unit

Stability Test Chamber BTST-1504

Sign In for Pricing
View Details
Frozen Tissue Sections, Prostate
CS510149 5x 5 µm

Frozen Tissue Sections, Prostate

Sign In for Pricing
View Details
Frozen Tissue Sections, Stomach
CS649046 5x 5 µm

Frozen Tissue Sections, Stomach

Sign In for Pricing
View Details
Tissue FFPE Sections, Prostate
CS712454 5x 5 µm

Tissue FFPE Sections, Prostate

Sign In for Pricing
View Details
HRP Conjugated c-Myc Rabbit Polyclonal Antibody
0912-4 100 µL

HRP Conjugated c-Myc Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CNTROB (NM_053051) Human Over-expression Lysate
LY403286 100 µg

CNTROB (NM_053051) Human Over-expression Lysate

Sign In for Pricing
View Details