Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1123 (PM1123)

This Recombinant Pasteurella multocida Uncharacterized protein PM1123 (PM1123) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1123

UniProt

Q9CLT6

Expression Region

1-123

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLASKAVFKYKIFPTGTITTFNLRPLLVSDINQNDGGMVLCSSAVSSINLPSILLIHSY ISFMLTLCFFLSLSTILSEMINFISISGTYKFFINIIICYKHKSSAYCVYTIVYTIKKKS TLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Complement component C1q receptor (CD93) ELISA Kit
MBS7206061-01 48 Well

Bovine Complement component C1q receptor (CD93) ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component C1q receptor (CD93) ELISA Kit
MBS7206061-02 96 Well

Bovine Complement component C1q receptor (CD93) ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component C1q receptor (CD93) ELISA Kit
MBS7206061-03 5x 96 Well

Bovine Complement component C1q receptor (CD93) ELISA Kit

Sign In for Pricing
View Details
Bovine Complement component C1q receptor (CD93) ELISA Kit
MBS7206061-04 10x 96 Well

Bovine Complement component C1q receptor (CD93) ELISA Kit

Sign In for Pricing
View Details
Connexin 43 (E7N2R) XP® Rabbit Monoclonal Antibody
CST 83649T 20 µL

Connexin 43 (E7N2R) XP® Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Gstt3 (NM_001137643) Rat Untagged Clone
RN215195 10 µg

Gstt3 (NM_001137643) Rat Untagged Clone

Sign In for Pricing
View Details