Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pasteurella multocida Uncharacterized protein PM1123 (PM1123)

This Recombinant Pasteurella multocida Uncharacterized protein PM1123 (PM1123) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Uncharacterized protein PM1123

UniProt

Q9CLT6

Expression Region

1-123

Origin

Pasteurella multocida (strain Pm70)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MLLASKAVFKYKIFPTGTITTFNLRPLLVSDINQNDGGMVLCSSAVSSINLPSILLIHSY ISFMLTLCFFLSLSTILSEMINFISISGTYKFFINIIICYKHKSSAYCVYTIVYTIKKKS TLS

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olr1 3'UTR GFP Stable Cell Line
TU165681 1.0 mL

Olr1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
AF488 Anti-Mouse CD18 Antibody [M18/2]
MBS2569696-01 0.025 mg

AF488 Anti-Mouse CD18 Antibody [M18/2]

Sign In for Pricing
View Details
AF488 Anti-Mouse CD18 Antibody [M18/2]
MBS2569696-02 0.1 mg

AF488 Anti-Mouse CD18 Antibody [M18/2]

Sign In for Pricing
View Details
AF488 Anti-Mouse CD18 Antibody [M18/2]
MBS2569696-03 5x 0.1 mg

AF488 Anti-Mouse CD18 Antibody [M18/2]

Sign In for Pricing
View Details
Terodiline hydrochloride
sc-253624 5 mg

Terodiline hydrochloride

Sign In for Pricing
View Details
RSRC2 shRNA (h) Lentiviral Particles
sc-95973-V 200 µL

RSRC2 shRNA (h) Lentiviral Particles

Sign In for Pricing
View Details