Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

This Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD) spans the amino acid sequence from region 37-159.

Product Specifications

Product Name Alternative

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, CybS, CII-4, QPs3, Succinate dehydrogenase complex subunit D, Succinate-ubiquinone oxidoreductase cyto

UniProt

A5GZW8

Expression Region

37-159

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DRHTPGWCGVQHIHLSPSHQASSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLA AALTLHGHWGIGQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAML WKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL
BNC940151-500 1x 500 µL

CD11a (Cris-3), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL
BNC680050-500 1x 500 µL

IgA Secretory Component (SC05), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL
BNC400978-500 1x 500 µL

CD7 (T3-3A1), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL
BNC680257-500 1x 500 µL

Cytokeratin, HMW (AE-3), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HSP60 (GROEL/730), CF594 conjugate, 0.1mg/mL
BNC940730-100 1x 100 µL

HSP60 (GROEL/730), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Progesterone Receptor (PR501), CF568 conjugate, 0.1mg/mL
BNC680501-500 1x 500 µL

Progesterone Receptor (PR501), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details