Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD)

This Recombinant Pig Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial (SDHD) spans the amino acid sequence from region 37-159.

Product Specifications

Product Name Alternative

Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial, CybS, CII-4, QPs3, Succinate dehydrogenase complex subunit D, Succinate-ubiquinone oxidoreductase cyto

UniProt

A5GZW8

Expression Region

37-159

Origin

Sus scrofa (Pig)

Field of Research

Neuroscience; Metabolism Research

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

DRHTPGWCGVQHIHLSPSHQASSKAASLHWTGERVVSVLLLGLLPAAYLNPCSAMDYSLA AALTLHGHWGIGQVVTDYVRGDALQKVAKAGLLALSAFTFAGLCYFNYHDVGICKAVAML WKL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

UBALD1 (NM_145253) Human Recombinant Protein
TP306877L 1 mg

UBALD1 (NM_145253) Human Recombinant Protein

Sign In for Pricing
View Details
FAM18B2 (TVP23C) Human Gene Knockout Kit (CRISPR)
KN401881 1 Kit

FAM18B2 (TVP23C) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Human FDCSP activation kit by CRISPRa
GA116934 1 Kit

Human FDCSP activation kit by CRISPRa

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112H-01 50 Tests

PE/Cyanine7 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112H-02 100 Tests

PE/Cyanine7 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details
PE/Cyanine7 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]
E-AB-F1112H-03 2x 100 Tests

PE/Cyanine7 Anti-Mouse CD45R/B220 Antibody[RA3.3A 1/6.1]

Sign In for Pricing
View Details