Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

This Recombinant Chicken Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, Oligosaccharyl transferase subunit DAD1, EC= 2.4.1.119, Defender against cell death 1, DAD

UniProt

O13113

Expression Region

1-123

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTAGSGVGAAGSVGSVVRRFLAEYGSGTSSRLKVLDAYLLYVMLTGALQFGYCLGVGT FPFNSFLSGFISAVGSFILGVCLRIQINPQNKGEFQGISPERAFADFLFANTILHLVVIN FVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL
BNC040645-500 1x 500 µL

FOXP3 (3G3), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD86 (BU63), CF488A conjugate, 0.1mg/mL
BNC880193-100 1x 100 µL

CD86 (BU63), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL
BNC040994-100 1x 100 µL

TNF alpha (J2D10), CF405S conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL
BNC400040-100 1x 100 µL

CD35 / CR1 (E11), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL
BNC400383-100 1x 100 µL

Cytokeratin 8 (K8/383), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Thymidylate Synthase (TMS715), CF640R conjugate, 0.1mg/mL
BNC400715-500 1x 500 µL

Thymidylate Synthase (TMS715), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details