Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chicken Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1)

This Recombinant Chicken Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1 (DAD1) spans the amino acid sequence from region 1-123.

Product Specifications

Product Name Alternative

Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit DAD1, Oligosaccharyl transferase subunit DAD1, EC= 2.4.1.119, Defender against cell death 1, DAD

UniProt

O13113

Expression Region

1-123

Origin

Gallus gallus (Chicken)

Field of Research

Cell Biology

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MSGTAGSGVGAAGSVGSVVRRFLAEYGSGTSSRLKVLDAYLLYVMLTGALQFGYCLGVGT FPFNSFLSGFISAVGSFILGVCLRIQINPQNKGEFQGISPERAFADFLFANTILHLVVIN FVG

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

KRTAP5P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)
60969111 3x 1.0 µg

KRTAP5P2 sgRNA CRISPR/Cas9 All-in-One Lentivector set (Human)

Sign In for Pricing
View Details
CIRH1A Polyclonal Conjugated Antibody
C31610 100 µL

CIRH1A Polyclonal Conjugated Antibody

Sign In for Pricing
View Details
GTF2IRD1 antibody - C-terminal region (ARP33735_T100)
ARP33735_T100 100 µL

GTF2IRD1 antibody - C-terminal region (ARP33735_T100)

Sign In for Pricing
View Details
GOLGA1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61533R-BF488-01 20 µL

GOLGA1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
GOLGA1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated
bsm-61533R-BF488-02 100 µL

GOLGA1 Recombinant Antibody, AbBy Fluor™ 488 Conjugated

Sign In for Pricing
View Details
Danio rerio (Zebrafish) Opn1sw1 Antibody Fluoro594 Conjugated
orb3166335 200 µL

Danio rerio (Zebrafish) Opn1sw1 Antibody Fluoro594 Conjugated

Sign In for Pricing
View Details