Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rhodobacter sphaeroides Protein CrcB homolog (crcB)

This Recombinant Rhodobacter sphaeroides Protein CrcB homolog (crcB) spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Protein CrcB homolog

UniProt

A3PGP0

Expression Region

1-124

Origin

Rhodobacter sphaeroides (strain ATCC 17029 / ATH 2.4.9)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MISSLLQVALGGALGASARYLTNVGSMRLFGPAFPVGTMIVNVVGSFLMGVLVVVLAHKG NRYAPFLMTGMLGGFTTFSAFSLDAVTLYERGQAGLAAAYVGLSVGLSLAGLMAGMAAVR GWMA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL
BNC740460-100 1x 100 µL

CD44 Standard (156-3C11), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45 / LCA (2B11 + PD7/26), 0.2mg/mL
BNUB0745-100 1x 100 µL

CD45 / LCA (2B11 + PD7/26), 0.2mg/mL

Sign In for Pricing
View Details
Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF740 conjugate, 0.1mg/mL
BNC741556-500 1x 500 µL

Ep-CAM / CD326 (Epithelial Marker) (EGP40/1556R), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL
BNC882809-100 1x 100 µL

CELA3B / ELA3B (Pancreatic Function Marker) (CELA3B/2809R), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD45RB (BRA-11G), CF488A conjugate, 0.1mg/mL
BNC880174-500 1x 500 µL

CD45RB (BRA-11G), CF488A conjugate, 0.1mg/mL

Sign In for Pricing
View Details
CD31 / PECAM-1 (C31.3), CF740 conjugate, 0.1mg/mL
BNC740049-500 1x 500 µL

CD31 / PECAM-1 (C31.3), CF740 conjugate, 0.1mg/mL

Sign In for Pricing
View Details