Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit G

This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit G spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G, Mrp complex subunit G, Multiple resistance and pH homeostasis protein G

UniProt

O05227

Expression Region

1-124

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLW FVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKE DSYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NF1 Antibody
KC-24898-01 50 μL

NF1 Antibody

Sign In for Pricing
View Details
NF1 Antibody
KC-24898-02 100 µL

NF1 Antibody

Sign In for Pricing
View Details
NF1 Antibody
KC-24898-03 1 mL

NF1 Antibody

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS627743 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Decanoyl-L-carnitine-d3 Chloride
TRC-D212583-25MG 25 mg

Decanoyl-L-carnitine-d3 Chloride

Sign In for Pricing
View Details
AMPK gamma 3 (PRKAG3) Human Gene Knockout Kit (CRISPR)
KN422787 1 Kit

AMPK gamma 3 (PRKAG3) Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details