Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit G

This Recombinant Bacillus subtilis Na (+) /H (+) antiporter subunit G spans the amino acid sequence from region 1-124.

Product Specifications

Product Name Alternative

Na (+) /H (+) antiporter subunit G, Mrp complex subunit G, Multiple resistance and pH homeostasis protein G

UniProt

O05227

Expression Region

1-124

Origin

Bacillus subtilis (strain 168)

Form

Lyophilized powder

Storage Conditions

Storage Condition: Store at -20°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. Shelf Life: The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C. Notes: Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week

Notes

For research use only.

Preservative

Tris/PBS-based buffer, 6% Trehalose, pH 8.0

AA Sequence

MIETAKVVVAVFILLGALICLIASFGVLRLPDVFTRAHAASKGSTLGVNMILLGVFFYLW FVTGELSAKILLGILFIFITSPIGGHLICRAAYNSGVKLDERSVQDDYNGIRNFVIKRKE DSYL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

PTP1B Mouse Monoclonal Antibody [D0-C7]
M1511-7 100 µL

PTP1B Mouse Monoclonal Antibody [D0-C7]

Sign In for Pricing
View Details
PXMP2 (NM_018663) Human Recombinant Protein
TP309935L 1 mg

PXMP2 (NM_018663) Human Recombinant Protein

Sign In for Pricing
View Details
Recombinant Histone H2B (Acetyl Lys46) Monoclonal Antibody
AN301406L-01 50 µL

Recombinant Histone H2B (Acetyl Lys46) Monoclonal Antibody

Sign In for Pricing
View Details
Recombinant Histone H2B (Acetyl Lys46) Monoclonal Antibody
AN301406L-02 100 µL

Recombinant Histone H2B (Acetyl Lys46) Monoclonal Antibody

Sign In for Pricing
View Details
SERPINA12 (NM_173850) Human Recombinant Protein
TP308148 20 µg

SERPINA12 (NM_173850) Human Recombinant Protein

Sign In for Pricing
View Details
Troxerutin (85%)
TRC-T893200-50MG 50 mg

Troxerutin (85%)

Sign In for Pricing
View Details